PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G033900.2
Common NameB456_005G033900, LOC105796556
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 304aa    MW: 33114.5 Da    PI: 6.5233
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G033900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1092.5e-343993155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  Gorai.005G033900.2 39 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 93
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-333694IPR009057Homeodomain-like
PROSITE profilePS5129413.0953696IPR017930Myb domain
SuperFamilySSF466891.79E-173896IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-243994IPR006447Myb domain, plants
PfamPF002499.2E-94192IPR001005SANT/Myb domain
PfamPF143792.9E-26137182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MYSGIRSLSL DGCVGDYQGS LDGTNLPGDA CLVLTTDPKP RLRWTAELHE RFVDAVTQLG  60
GPDKATPKTI MRTMGVKGLT LYHLKSHLQK YRLGKQSAKE STDNSKDVSS IAERQDTGSS  120
TTASSRMVAQ DVNDGYQVTE ALRVQMEVQR KLHEQLEVQR RLQLRIEAQG KYLQSILEKA  180
CTALNDEAAA STGLEAAREE LSELAIKVSN DCQGMIPLDN IKLPSLSEFT AALENKTASN  240
MPTRIGDCSI ESFLTSSRSP LSQTGVGSQA VTMKRPRPPF GIGDPFPLGG IRQEIEWVMP  300
NIS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1273277KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012481754.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK53e-69APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0D2N7E10.0A0A0D2N7E1_G
STRINGVIT_05s0029g00060.t011e-154(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-127G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]